(data stored in SCRATCH zone)

EMBL: CP002399.PE140

CP002399.PE140       Location/Qualifiers
FT   CDS             145101..145541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0141"
FT                   /product="regulatory protein MerR"
FT                   /note="KEGG: saq:Sare_0115 MerR family transcriptional
FT                   regulator; PFAM: regulatory protein MerR; SMART: regulatory
FT                   protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05694"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ADU05694.1"
FT                   /translation="MSEEYVGSGDQAYEAKVLMISVAARMAGMHPQTLRQYDRLGLVQA
FT                   GRASGGGRRYSVRDVVLLREVQRLSQDDGINLAGVKRIIGLERLLEEAQQRVARLEAEL
FT                   DAAYRRIAELESLGGFPRGDLVPTNRTSTALVVWRPRRAPDR"
     MSEEYVGSGD QAYEAKVLMI SVAARMAGMH PQTLRQYDRL GLVQAGRASG GGRRYSVRDV        60
     VLLREVQRLS QDDGINLAGV KRIIGLERLL EEAQQRVARL EAELDAAYRR IAELESLGGF       120
     PRGDLVPTNR TSTALVVWRP RRAPDR                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page