(data stored in SCRATCH zone)

EMBL: CP002399.PE141

CP002399.PE141       Location/Qualifiers
FT   CDS             145718..145924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0142"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_0117 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05695"
FT                   /inference="similar to AA sequence:KEGG:Strop_0117"
FT                   /protein_id="ADU05695.1"
FT                   /translation="MTEPAKKVAERAEERLEKVAENVRERFDRVTEGRFSDKVKEGRFA
FT                   DQTDHGVDRARDDERRKKQGGST"
     MTEPAKKVAE RAEERLEKVA ENVRERFDRV TEGRFSDKVK EGRFADQTDH GVDRARDDER        60
     RKKQGGST                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page