(data stored in SCRATCH zone)

EMBL: CP002399.PE147

CP002399.PE147       Location/Qualifiers
FT   CDS             149289..149555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0148"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4346 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05701"
FT                   /inference="similar to AA sequence:KEGG:Sare_4346"
FT                   /protein_id="ADU05701.1"
FT                   /translation="MTGRYVIHLPVRAADLARAKMLGRTAGRSLAFLAVVELGGITVST
FT                   EDDQSVRHWVFCDRKLDGGRRCVLRADHETPCLARLPGRTGGR"
     MTGRYVIHLP VRAADLARAK MLGRTAGRSL AFLAVVELGG ITVSTEDDQS VRHWVFCDRK        60
     LDGGRRCVLR ADHETPCLAR LPGRTGGR                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page