(data stored in SCRATCH zone)

EMBL: CP002399.PE150

CP002399.PE150       Location/Qualifiers
FT   CDS             152911..153549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0151"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0121 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05704"
FT                   /inference="similar to AA sequence:KEGG:Sare_0121"
FT                   /protein_id="ADU05704.1"
FT                   /translation="MNGSLAYVVTTLGCLVGVAGVVIAVIALRRSRSASGPKTKAAPGD
FT                   PFRDRDADALRGDPRALKPGDIVEIRSVPYTVRGSVHLVEGGWSWAEHLLDDAGGVKRW
FT                   LSVESDPDLELVLWTSEPGATVTPGAPTLEIAGRRYNWDESGQARYTATEGTGLDPHGT
FT                   MRYYDYQAPGGARLSFEAYGEAGWEVNLGEELRRAEVMIYPQGGSETVR"
     MNGSLAYVVT TLGCLVGVAG VVIAVIALRR SRSASGPKTK AAPGDPFRDR DADALRGDPR        60
     ALKPGDIVEI RSVPYTVRGS VHLVEGGWSW AEHLLDDAGG VKRWLSVESD PDLELVLWTS       120
     EPGATVTPGA PTLEIAGRRY NWDESGQARY TATEGTGLDP HGTMRYYDYQ APGGARLSFE       180
     AYGEAGWEVN LGEELRRAEV MIYPQGGSET VR                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page