(data stored in SCRATCH zone)

EMBL: CP002399.PE152

CP002399.PE152       Location/Qualifiers
FT   CDS             154042..154467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0153"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0123 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05706"
FT                   /inference="similar to AA sequence:KEGG:Sare_0123"
FT                   /protein_id="ADU05706.1"
FT                   /translation="MTYRRWFVVGVAVAVIGALIAAFTIFYGNFSPRGYVEDNFSRASG
FT                   RDIGSNAIAYTSRKTPSEVSKQITDAWRPADQYVDGSGVYLRYDDDSVVILPLAVGSVI
FT                   LLEKMTTAYPRYHTVVGNSWGWGRGSTVRGGGPGSGK"
     MTYRRWFVVG VAVAVIGALI AAFTIFYGNF SPRGYVEDNF SRASGRDIGS NAIAYTSRKT        60
     PSEVSKQITD AWRPADQYVD GSGVYLRYDD DSVVILPLAV GSVILLEKMT TAYPRYHTVV       120
     GNSWGWGRGS TVRGGGPGSG K                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page