(data stored in SCRATCH zone)

EMBL: CP002399.PE154

CP002399.PE154       Location/Qualifiers
FT   CDS             154920..155693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0155"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0125 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05708"
FT                   /inference="similar to AA sequence:KEGG:Sare_0125"
FT                   /protein_id="ADU05708.1"
FT                   /translation="MSGKPAQHSAGKDKRTQTVIWSVVVGIVVVVCAIGVFSGDSDTSV
FT                   PAPAADERSGTVPILRAAADSQGICYGWELLDVYDEVSVGSNLGDGTTVVDAPGCTRWI
FT                   AVSANVRYTSSSSESEDSATIRIKGSDDIEFADLAAIETRLSRFGLDEEAFVDDPGWAV
FT                   TRAATILPLLAAERGLAEPAATPTAGPSTAAAPLPDAGNDFWRDRWIYVLSSLGLFLFA
FT                   ALFLVVGVRQRRNHRGRVPAQRAGAGAAGRTRSRR"
     MSGKPAQHSA GKDKRTQTVI WSVVVGIVVV VCAIGVFSGD SDTSVPAPAA DERSGTVPIL        60
     RAAADSQGIC YGWELLDVYD EVSVGSNLGD GTTVVDAPGC TRWIAVSANV RYTSSSSESE       120
     DSATIRIKGS DDIEFADLAA IETRLSRFGL DEEAFVDDPG WAVTRAATIL PLLAAERGLA       180
     EPAATPTAGP STAAAPLPDA GNDFWRDRWI YVLSSLGLFL FAALFLVVGV RQRRNHRGRV       240
     PAQRAGAGAA GRTRSRR                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page