(data stored in SCRATCH zone)

EMBL: CP002399.PE158

CP002399.PE158       Location/Qualifiers
FT   CDS             159246..159974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0159"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_0123 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05712"
FT                   /inference="similar to AA sequence:KEGG:Strop_0123"
FT                   /protein_id="ADU05712.1"
FT                   /translation="MSYPERAAPRRPGTVLAAAALLLVMAVGAVAYAVVNLAVGGGTVD
FT                   RFRDAAAERTGASGGDVDQVAGLLRGSTVLAAVLGVLAALLLVGLALGLLAGRSGARTA
FT                   TWVVAGTGLLCGCCGLAVLVGQRAAPLRLGADDRITADLLGLVGDAYPSWWIPVNATLS
FT                   VAQILGYLVVAALLTLPSSGAFLRRRTAPLRLSGYGSTVSGAAAPGPTPWGPPPGLNPP
FT                   PSVPPATPPGGFPPPPEDSR"
     MSYPERAAPR RPGTVLAAAA LLLVMAVGAV AYAVVNLAVG GGTVDRFRDA AAERTGASGG        60
     DVDQVAGLLR GSTVLAAVLG VLAALLLVGL ALGLLAGRSG ARTATWVVAG TGLLCGCCGL       120
     AVLVGQRAAP LRLGADDRIT ADLLGLVGDA YPSWWIPVNA TLSVAQILGY LVVAALLTLP       180
     SSGAFLRRRT APLRLSGYGS TVSGAAAPGP TPWGPPPGLN PPPSVPPATP PGGFPPPPED       240
     SR                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page