(data stored in SCRATCH zone)

EMBL: CP002399.PE160

CP002399.PE160       Location/Qualifiers
FT   CDS             160935..161474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0161"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="TIGRFAM: orotate phosphoribosyltransferase; KEGG:
FT                   saq:Sare_0130 orotate phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05714"
FT                   /inference="protein motif:TFAM:TIGR00336"
FT                   /protein_id="ADU05714.1"
FT                   /translation="MGDHDDLRKFITDLAVVHGRVVLSSGREADWYVDLRRVTLHHEAA
FT                   PLIGRVMRDLTADWAYDAVGGLTLGADPVAAAMLHASAGTGHAVDAFVVRKEGKAHGLQ
FT                   RRIEGPDVSGRRVLAVEDTSTTGGSVLTAVDALREAGAEVVGVAVIVDRGAGDTVRAAG
FT                   LPYRAAYTLADLGLVA"
     MGDHDDLRKF ITDLAVVHGR VVLSSGREAD WYVDLRRVTL HHEAAPLIGR VMRDLTADWA        60
     YDAVGGLTLG ADPVAAAMLH ASAGTGHAVD AFVVRKEGKA HGLQRRIEGP DVSGRRVLAV       120
     EDTSTTGGSV LTAVDALREA GAEVVGVAVI VDRGAGDTVR AAGLPYRAAY TLADLGLVA        179
//

If you have problems or comments...

PBIL Back to PBIL home page