(data stored in SCRATCH zone)

EMBL: CP002399.PE189

CP002399.PE189       Location/Qualifiers
FT   CDS             192469..193761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0190"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; KEGG:
FT                   stp:Strop_0142 acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase-like"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05743"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ADU05743.1"
FT                   /translation="MQSVRRVAVIGGNRIPFARSNSRYAHASNADMLGAALDGLIARFG
FT                   LAGERVGEMVAGAVLKHSRDFNLTREVVLGSRLDPHTPAYDIQQACGTGLEAAILVANK
FT                   IALGQIEVGIAGGVDTTSDAPLAVNEDMRRTLIQLNSARTLGERLKIAAKLRPHQPFKP
FT                   EIPRNAEPRTGLSMGEHAARTALRWNVDRTAQDELALRSHQRLAAAYDKGFFDDLMTPY
FT                   LGLTRDQNLRPDTSLEKLGSLKPVFGASGADAERATMTAGNSSPLTDGASTVLLASEEW
FT                   AKAHNLPVLAWFSWSEAAAVDFVHGDEGLLMAPAYAVPRMLARAGLSLQDFDFYEIHEA
FT                   FASQVLATLAAWESPEFCKERLGLDAPLGSIDRDKLNVNGSSLAAGHPFAATGGRIVAT
FT                   LAKLLDEKGSGRGLISICAAGGQGVTAILER"
     MQSVRRVAVI GGNRIPFARS NSRYAHASNA DMLGAALDGL IARFGLAGER VGEMVAGAVL        60
     KHSRDFNLTR EVVLGSRLDP HTPAYDIQQA CGTGLEAAIL VANKIALGQI EVGIAGGVDT       120
     TSDAPLAVNE DMRRTLIQLN SARTLGERLK IAAKLRPHQP FKPEIPRNAE PRTGLSMGEH       180
     AARTALRWNV DRTAQDELAL RSHQRLAAAY DKGFFDDLMT PYLGLTRDQN LRPDTSLEKL       240
     GSLKPVFGAS GADAERATMT AGNSSPLTDG ASTVLLASEE WAKAHNLPVL AWFSWSEAAA       300
     VDFVHGDEGL LMAPAYAVPR MLARAGLSLQ DFDFYEIHEA FASQVLATLA AWESPEFCKE       360
     RLGLDAPLGS IDRDKLNVNG SSLAAGHPFA ATGGRIVATL AKLLDEKGSG RGLISICAAG       420
     GQGVTAILER                                                              430
//

If you have problems or comments...

PBIL Back to PBIL home page