(data stored in SCRATCH zone)

EMBL: CP002399.PE190

CP002399.PE190       Location/Qualifiers
FT   CDS             complement(193812..196109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0191"
FT                   /product="PKD domain containing protein"
FT                   /note="KEGG: cai:Caci_1999 protease-like protein; PFAM: PKD
FT                   domain containing protein; SMART: PKD domain containing
FT                   protein; Parallel beta-helix repeat"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05744"
FT                   /inference="protein motif:PFAM:PF00801"
FT                   /protein_id="ADU05744.1"
FT                   /translation="MHRPLLAGLTTTVLTGGSLLVLAAPSQAADTTTIYVRQTAAACSD
FT                   TGPGTLGAPFCSINPAVARVEPGQTVDIGQGTYPERVTVGRSGTPEQPITIVADGSATI
FT                   NGPTAGVVVHGQHDIVLQNIRVAKTADGPALDLANASGLTVQGGSFLPADTATAPIVRL
FT                   TAVSRTTLAQIIVKGVMPASGISMDTATTGVVVRSATVGGTYKVAEPNVGIRIDGPGNT
FT                   ILNSTVGAFTGAGVAIGPAAADTVVANTQVQSGAGLGIHVRGAARTAITNNYVRDHCSD
FT                   GIRVDGDATGVSVQNNIMNSNGITTRSYCDPADPPGVEIGLFDAAAGSTVVDYNNTYHY
FT                   SSPSDTAYSWNGTRMGVQAFRLASGQAAHDLDTSYTTEAEDSANSAAPGFQATDRAGNA
FT                   RADNPNRPNTGAGPVPWADRGVTEYLGAPRAWVETKLDLGTRTVTADASLSLPGYRPIS
FT                   RYVFDFGDGTVVTSDKPVASHAYTTTGDYTVSVTVSGSDNRTGTATQGISVLRRTGTVG
FT                   LLALVNLRYASATAGRVLTADKATLAGDGQFDLADAGNGRVAVLSRSVGRYLVNSGAIL
FT                   PNSPAVTDEQTFDLVTNADGTISLRWSGRAYVGVDGNAQLVATATAIGTREKFYRVNLA
FT                   DANRTLKAGVNGRFVSAESAGTKPLIANRTSAGPWERFDLLDLGSGKVALLAQANGKVV
FT                   CADGTGTKPLIANRTSAGAWETFVLVRNADGTVSLKATINNRYVSAESAGAKPLIANRT
FT                   TVGPWEKFTVGG"
     MHRPLLAGLT TTVLTGGSLL VLAAPSQAAD TTTIYVRQTA AACSDTGPGT LGAPFCSINP        60
     AVARVEPGQT VDIGQGTYPE RVTVGRSGTP EQPITIVADG SATINGPTAG VVVHGQHDIV       120
     LQNIRVAKTA DGPALDLANA SGLTVQGGSF LPADTATAPI VRLTAVSRTT LAQIIVKGVM       180
     PASGISMDTA TTGVVVRSAT VGGTYKVAEP NVGIRIDGPG NTILNSTVGA FTGAGVAIGP       240
     AAADTVVANT QVQSGAGLGI HVRGAARTAI TNNYVRDHCS DGIRVDGDAT GVSVQNNIMN       300
     SNGITTRSYC DPADPPGVEI GLFDAAAGST VVDYNNTYHY SSPSDTAYSW NGTRMGVQAF       360
     RLASGQAAHD LDTSYTTEAE DSANSAAPGF QATDRAGNAR ADNPNRPNTG AGPVPWADRG       420
     VTEYLGAPRA WVETKLDLGT RTVTADASLS LPGYRPISRY VFDFGDGTVV TSDKPVASHA       480
     YTTTGDYTVS VTVSGSDNRT GTATQGISVL RRTGTVGLLA LVNLRYASAT AGRVLTADKA       540
     TLAGDGQFDL ADAGNGRVAV LSRSVGRYLV NSGAILPNSP AVTDEQTFDL VTNADGTISL       600
     RWSGRAYVGV DGNAQLVATA TAIGTREKFY RVNLADANRT LKAGVNGRFV SAESAGTKPL       660
     IANRTSAGPW ERFDLLDLGS GKVALLAQAN GKVVCADGTG TKPLIANRTS AGAWETFVLV       720
     RNADGTVSLK ATINNRYVSA ESAGAKPLIA NRTTVGPWEK FTVGG                       765
//

If you have problems or comments...

PBIL Back to PBIL home page