(data stored in SCRATCH zone)

EMBL: CP002399.PE200

CP002399.PE200       Location/Qualifiers
FT   CDS             207264..208781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0201"
FT                   /product="amidophosphoribosyltransferase"
FT                   /note="KEGG: saq:Sare_0163 amidophosphoribosyltransferase;
FT                   TIGRFAM: amidophosphoribosyltransferase; PFAM: glutamine
FT                   amidotransferase class-II; phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05754"
FT                   /inference="protein motif:TFAM:TIGR01134"
FT                   /protein_id="ADU05754.1"
FT                   /translation="MPRGDGRLSHDLDPQRPGPQDACGVFGVWAPGEEVANLTYFGLYA
FT                   LQHRGQEAAGIAVSDGSGVVVYKDLGLVAQVFDEPTLASLRGHVAIGHARYSTTGGSTW
FT                   ENAQPTIRATTAGTTIALAHNGNLVNTAELQREAAVRGLDSDGSTNDTSLVTMLLASRP
FT                   DLSVEAAALEVLPQLRGAFSFVFMDESTLYAARDAHGVRPLVLGRLERGWVVASETAAL
FT                   DIVGASVVREVEPGELIAIDENGLRSSRFASPEPKGCLFEYVYIARPDATIAGRNVHAA
FT                   RVQIGRQLAKEHPVEADLVIPVPESGTPAAIGYAEESGITYGQGLMKNPYVGRTFIQPS
FT                   QTLRALGVRLKLNPLRQNVRGKRLVVVDDSIVRGTTQRAIVRLLREAGALEVHVRISSP
FT                   PVSWPCFYGIDFATRAELLANGLDNDGIRRSIGADSLGYVSLPGLIAATEQPKSRLCRA
FT                   CFDGEYPIELPAGNLIGKHVLEGVGRRVAAEAAGPTGPLVATPTHHP"
     MPRGDGRLSH DLDPQRPGPQ DACGVFGVWA PGEEVANLTY FGLYALQHRG QEAAGIAVSD        60
     GSGVVVYKDL GLVAQVFDEP TLASLRGHVA IGHARYSTTG GSTWENAQPT IRATTAGTTI       120
     ALAHNGNLVN TAELQREAAV RGLDSDGSTN DTSLVTMLLA SRPDLSVEAA ALEVLPQLRG       180
     AFSFVFMDES TLYAARDAHG VRPLVLGRLE RGWVVASETA ALDIVGASVV REVEPGELIA       240
     IDENGLRSSR FASPEPKGCL FEYVYIARPD ATIAGRNVHA ARVQIGRQLA KEHPVEADLV       300
     IPVPESGTPA AIGYAEESGI TYGQGLMKNP YVGRTFIQPS QTLRALGVRL KLNPLRQNVR       360
     GKRLVVVDDS IVRGTTQRAI VRLLREAGAL EVHVRISSPP VSWPCFYGID FATRAELLAN       420
     GLDNDGIRRS IGADSLGYVS LPGLIAATEQ PKSRLCRACF DGEYPIELPA GNLIGKHVLE       480
     GVGRRVAAEA AGPTGPLVAT PTHHP                                             505
//

If you have problems or comments...

PBIL Back to PBIL home page