(data stored in SCRATCH zone)

EMBL: CP002399.PE23

CP002399.PE23        Location/Qualifiers
FT   CDS             25879..27255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0023"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   kfl:Kfla_6909 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05577"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADU05577.1"
FT                   /translation="MTSTTAVPADPPVDLWSPRLRAMTVGSVALVSLLAFEALAVGTAM
FT                   PTVARSLDGLGLYALAFGGSFASGVVAMVASGIWCDARGPRPAMWHGVVWFVAGLVVAG
FT                   AATTMEVLVVGRVVQGFGSGLVSVALYVVVGQAYPEQLRRRIFAAFAAAWVVPSLVGPA
FT                   LAGLIVEHLGWRWVFLAVPAVAIPAALLVQPGLRALTATVATRPPAGALARIGWACGAG
FT                   ASAALLHYGGQQRGVLAAALIAGALAGLFVCVPHLLPAGFLRAARGLPTVIGLRALASA
FT                   AFVAAEVVIPLMLSRERGFSPTGAGLVLTVGALSWSVGSWIQGRIRSPRSAATLPRAGL
FT                   ACITIGTAGVASALVPGLPVLPAVLSWSVAGLGMGLLYPSLSVLTLEQSAPAEQGRNSS
FT                   ALQLGDSLAAATVLALTGAVLAAGASPGPAGFATTLAVAATCGLLGLLLAGRVVLRPTP
FT                   "
     MTSTTAVPAD PPVDLWSPRL RAMTVGSVAL VSLLAFEALA VGTAMPTVAR SLDGLGLYAL        60
     AFGGSFASGV VAMVASGIWC DARGPRPAMW HGVVWFVAGL VVAGAATTME VLVVGRVVQG       120
     FGSGLVSVAL YVVVGQAYPE QLRRRIFAAF AAAWVVPSLV GPALAGLIVE HLGWRWVFLA       180
     VPAVAIPAAL LVQPGLRALT ATVATRPPAG ALARIGWACG AGASAALLHY GGQQRGVLAA       240
     ALIAGALAGL FVCVPHLLPA GFLRAARGLP TVIGLRALAS AAFVAAEVVI PLMLSRERGF       300
     SPTGAGLVLT VGALSWSVGS WIQGRIRSPR SAATLPRAGL ACITIGTAGV ASALVPGLPV       360
     LPAVLSWSVA GLGMGLLYPS LSVLTLEQSA PAEQGRNSSA LQLGDSLAAA TVLALTGAVL       420
     AAGASPGPAG FATTLAVAAT CGLLGLLLAG RVVLRPTP                               458
//

If you have problems or comments...

PBIL Back to PBIL home page