(data stored in SCRATCH zone)

EMBL: CP002399.PE232

CP002399.PE232       Location/Qualifiers
FT   CDS             complement(236799..237563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0233"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   saq:Sare_4961 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05786"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ADU05786.1"
FT                   /translation="MGVRVEHAGAVTTVILDRPEARNAVDGPTARALADAFRAFDADPD
FT                   AAVAVLWGAGGTFCAGADLKAVGTPRGNRVEPGGDAPMGPTRMRLSKPVIAAISGYAVA
FT                   GGLELALWCDLRVAESDATLGVFCRRWGVPLIDGGTVRLPRLIGESRAMDLILTGRAVG
FT                   ADEAYAMGLVNRLVAPGEARTAAEELAAAIARSPQTCLRNDRAAVRDGAGQPEPEAMAT
FT                   ELAYGLESLAVDGVRGAGRFADGAGRHGAPAG"
     MGVRVEHAGA VTTVILDRPE ARNAVDGPTA RALADAFRAF DADPDAAVAV LWGAGGTFCA        60
     GADLKAVGTP RGNRVEPGGD APMGPTRMRL SKPVIAAISG YAVAGGLELA LWCDLRVAES       120
     DATLGVFCRR WGVPLIDGGT VRLPRLIGES RAMDLILTGR AVGADEAYAM GLVNRLVAPG       180
     EARTAAEELA AAIARSPQTC LRNDRAAVRD GAGQPEPEAM ATELAYGLES LAVDGVRGAG       240
     RFADGAGRHG APAG                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page