(data stored in SCRATCH zone)

EMBL: CP002399.PE241

CP002399.PE241       Location/Qualifiers
FT   CDS             complement(242903..244444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0242"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   stp:Strop_4457 type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05795"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ADU05795.1"
FT                   /translation="MRFEPVSHDPRAQQPGVVSTVPPLAPPNGRHHVPGPAPAAPPAPP
FT                   PRPRVDFAVVRELRRELSERLTHWQRGREFDADAEEVERARLAVAVVSAYADSVRRAGT
FT                   PMAADSERLLLDQVTAELVGLGRLQTLLVDDSIEEVHILGCDQVRITRHGGGVDWAEPI
FT                   AETDDELVEILQAAARRAGATERSLSTSKPTLDLQLPDGSRLAAVFLVSHRPYAVIRKH
FT                   NTLEVSLEDIAGGRPDLDEMIDPLLRDFLRASMRAGLNIMVAGLAGAGKTTVIRALMDE
FT                   IPADEPYVLLEESRELLPARRGHKHRAVMSFESREGHGERGADGRPAGEVSIADLIPVS
FT                   LRMGVLRIIVGEVRSREIVPMLQAMTTSRGSMCTIHARTPSGVSERIIELALSHGREMT
FT                   VDQARRMAGNALDLIVYVTVEDETAIGGRKHRFVSHVEEVIGVGEGNRITTTTVFGPGP
FT                   DGRAVPRHLPERIRDQLLRVGYDARLLTRFVEAGVGAWRRPRHTRLGARPSGGPA"
     MRFEPVSHDP RAQQPGVVST VPPLAPPNGR HHVPGPAPAA PPAPPPRPRV DFAVVRELRR        60
     ELSERLTHWQ RGREFDADAE EVERARLAVA VVSAYADSVR RAGTPMAADS ERLLLDQVTA       120
     ELVGLGRLQT LLVDDSIEEV HILGCDQVRI TRHGGGVDWA EPIAETDDEL VEILQAAARR       180
     AGATERSLST SKPTLDLQLP DGSRLAAVFL VSHRPYAVIR KHNTLEVSLE DIAGGRPDLD       240
     EMIDPLLRDF LRASMRAGLN IMVAGLAGAG KTTVIRALMD EIPADEPYVL LEESRELLPA       300
     RRGHKHRAVM SFESREGHGE RGADGRPAGE VSIADLIPVS LRMGVLRIIV GEVRSREIVP       360
     MLQAMTTSRG SMCTIHARTP SGVSERIIEL ALSHGREMTV DQARRMAGNA LDLIVYVTVE       420
     DETAIGGRKH RFVSHVEEVI GVGEGNRITT TTVFGPGPDG RAVPRHLPER IRDQLLRVGY       480
     DARLLTRFVE AGVGAWRRPR HTRLGARPSG GPA                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page