(data stored in SCRATCH zone)

EMBL: CP002399.PE245

CP002399.PE245       Location/Qualifiers
FT   CDS             complement(246879..247445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0246"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4974 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05799"
FT                   /inference="similar to AA sequence:KEGG:Sare_4974"
FT                   /protein_id="ADU05799.1"
FT                   /translation="MRTRQSRRWEIFLLSIVLVVGSAGCGTEPEAVTRPLTGRAAAPAA
FT                   HSSAEENAAGKAALAAYSGYLDASRAASARSDPSHPALTRFLADPLLTRVRMAILDAKE
FT                   HGAMRTGKLVSDPEVVSVDLAARPPTVEIQDCLDASGYRLVYAKDRKAVPGTRGGRYLA
FT                   TATAVRYPDGRWLINGGAAHQDQPC"
     MRTRQSRRWE IFLLSIVLVV GSAGCGTEPE AVTRPLTGRA AAPAAHSSAE ENAAGKAALA        60
     AYSGYLDASR AASARSDPSH PALTRFLADP LLTRVRMAIL DAKEHGAMRT GKLVSDPEVV       120
     SVDLAARPPT VEIQDCLDAS GYRLVYAKDR KAVPGTRGGR YLATATAVRY PDGRWLINGG       180
     AAHQDQPC                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page