(data stored in SCRATCH zone)

EMBL: CP002399.PE25

CP002399.PE25        Location/Qualifiers
FT   CDS             28318..28515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0025"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0023 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05579"
FT                   /inference="similar to AA sequence:KEGG:Sare_0023"
FT                   /protein_id="ADU05579.1"
FT                   /translation="MLVFVATVVLYVFGFVFLYGVIRVGVRHGIEDAEANRPEVLRRRQ
FT                   LTTTESRDFAQENAFLTNPN"
     MLVFVATVVL YVFGFVFLYG VIRVGVRHGI EDAEANRPEV LRRRQLTTTE SRDFAQENAF        60
     LTNPN                                                                    65
//

If you have problems or comments...

PBIL Back to PBIL home page