(data stored in SCRATCH zone)

EMBL: CP002399.PE266

CP002399.PE266       Location/Qualifiers
FT   CDS             complement(267587..268324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0267"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: kfl:Kfla_2724
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05820"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADU05820.1"
FT                   /translation="MANTSRNLGLGHGSAFGERGVAKRLGTLSRHTSLTGRRLLEIGCG
FT                   DGTYTMRLVGAFEQIEAVDIQQDRLELFRERLAGDPAAAQKINVRELSATELDYPDESF
FT                   DLVTAIEVVEHIDDLDAALRQVRRVLVPGGCFALTTPNRWFPFETHGFLIRGKRYRPAR
FT                   GPFLPWIVPLHRRLADARCFTARGLSAQLRRAGLERVAVDYIMPPFDRSHFGRRIRPVT
FT                   DTVERSPLRFFGMALAVVARRPA"
     MANTSRNLGL GHGSAFGERG VAKRLGTLSR HTSLTGRRLL EIGCGDGTYT MRLVGAFEQI        60
     EAVDIQQDRL ELFRERLAGD PAAAQKINVR ELSATELDYP DESFDLVTAI EVVEHIDDLD       120
     AALRQVRRVL VPGGCFALTT PNRWFPFETH GFLIRGKRYR PARGPFLPWI VPLHRRLADA       180
     RCFTARGLSA QLRRAGLERV AVDYIMPPFD RSHFGRRIRP VTDTVERSPL RFFGMALAVV       240
     ARRPA                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page