(data stored in SCRATCH zone)

EMBL: CP002399.PE276

CP002399.PE276       Location/Qualifiers
FT   CDS             complement(275752..276897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0278"
FT                   /product="Polymorphic membrane protein Chlamydia"
FT                   /note="PFAM: Polymorphic membrane protein Chlamydia; KEGG:
FT                   kfl:Kfla_4105 polymorphic membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05830"
FT                   /inference="protein motif:PFAM:PF02415"
FT                   /protein_id="ADU05830.1"
FT                   /translation="MKSAVTLLALALTTATLPACGDDPAVAPAADVGSSAGPAAAPAAS
FT                   PSGRAGLGSARPSPSPATVTFRAGNPNGRAAVPAEARPVDTSRPTRTVGSGTPASCTSE
FT                   AVVKAVAAGGVITFDCGPAPVTITMKATAKVVNSHGPRVVLDGGGTVTLSGGGKRRILY
FT                   MNTCDEAQGWTTSHCQNQDHPRLTVQNLTFADGDATGDRTEGGGGGAIFVRGGRFTVIN
FT                   SRFVGNRCDRTGPDLGGAALRVLSQFENKPVYVVSSTFTGGVCANGGALSSIGVSWTVL
FT                   NSVFRDNRAVGTGANPARGGTPGGGSGGAIYCDGNEFAVRIAGTVIEDNSANEGGGAIF
FT                   FVSNNRTGTLKIDSSTLRRNPSRGFETKGHPGIFFLGAQIS"
     MKSAVTLLAL ALTTATLPAC GDDPAVAPAA DVGSSAGPAA APAASPSGRA GLGSARPSPS        60
     PATVTFRAGN PNGRAAVPAE ARPVDTSRPT RTVGSGTPAS CTSEAVVKAV AAGGVITFDC       120
     GPAPVTITMK ATAKVVNSHG PRVVLDGGGT VTLSGGGKRR ILYMNTCDEA QGWTTSHCQN       180
     QDHPRLTVQN LTFADGDATG DRTEGGGGGA IFVRGGRFTV INSRFVGNRC DRTGPDLGGA       240
     ALRVLSQFEN KPVYVVSSTF TGGVCANGGA LSSIGVSWTV LNSVFRDNRA VGTGANPARG       300
     GTPGGGSGGA IYCDGNEFAV RIAGTVIEDN SANEGGGAIF FVSNNRTGTL KIDSSTLRRN       360
     PSRGFETKGH PGIFFLGAQI S                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page