(data stored in SCRATCH zone)

EMBL: CP002399.PE279

CP002399.PE279       Location/Qualifiers
FT   CDS             complement(279150..279869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0281"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="KEGG: saq:Sare_4532 protein serine/threonine
FT                   phosphatase; PFAM: Protein phosphatase 2C-like; SMART:
FT                   protein phosphatase 2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05833"
FT                   /inference="protein motif:PFAM:PF00481"
FT                   /protein_id="ADU05833.1"
FT                   /translation="MTLILRSAILNDVGLVRTNNEDSALAGDRLVAVADGMGGLPAGEV
FT                   ASEIVIRILDELTPPTGADEAADALRAVVSTANQRIRAAITVDPARDGMGTTLTAALLA
FT                   GDTLVLAQVGDSRCYLLRDHELTQLTRDDTFVQALVDQGALSRDQARHHPQRSLVTRAV
FT                   QGSDAPPAVGALTVFPGDRLLLCSDGLSDYVEDAAIAAALATYGDRQQCGEQLVKLAHQ
FT                   AGAPDNVTVVISDVTEA"
     MTLILRSAIL NDVGLVRTNN EDSALAGDRL VAVADGMGGL PAGEVASEIV IRILDELTPP        60
     TGADEAADAL RAVVSTANQR IRAAITVDPA RDGMGTTLTA ALLAGDTLVL AQVGDSRCYL       120
     LRDHELTQLT RDDTFVQALV DQGALSRDQA RHHPQRSLVT RAVQGSDAPP AVGALTVFPG       180
     DRLLLCSDGL SDYVEDAAIA AALATYGDRQ QCGEQLVKLA HQAGAPDNVT VVISDVTEA        239
//

If you have problems or comments...

PBIL Back to PBIL home page