(data stored in SCRATCH zone)

EMBL: CP002399.PE284

CP002399.PE284       Location/Qualifiers
FT   CDS             complement(283067..283315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0286"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_4109 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05838"
FT                   /inference="similar to AA sequence:KEGG:Strop_4109"
FT                   /protein_id="ADU05838.1"
FT                   /translation="MEQRRHWWNGKWGRLARRDVFLRVDGDRWHVEQRAGGAEGISRFY
FT                   EHASVEEAEETIRALLDGTDTWRELSPRPPGGWAPSV"
     MEQRRHWWNG KWGRLARRDV FLRVDGDRWH VEQRAGGAEG ISRFYEHASV EEAEETIRAL        60
     LDGTDTWREL SPRPPGGWAP SV                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page