(data stored in SCRATCH zone)

EMBL: CP002399.PE285

CP002399.PE285       Location/Qualifiers
FT   CDS             complement(283393..283863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0287"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /note="KEGG: dra:DR_2422 large conductance mechanosensitive
FT                   channel; TIGRFAM: large conductance mechanosensitive
FT                   channel protein; PFAM: large-conductance mechanosensitive
FT                   channel"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05839"
FT                   /inference="protein motif:TFAM:TIGR00220"
FT                   /protein_id="ADU05839.1"
FT                   /translation="MLKGFKDFIMRGNVVDLAVGVVIGAAFTGVVTQLTKSFLEPLVRV
FT                   FIALITGSEDGLSGSTPKFRGIPFDWVAFVNAAITFVLTAAALYFLVVYPMNRLAERRK
FT                   RGEEPPPSAPSEEVKLLTEIRDALLAGNHGTPGQRSALDDVLGRRQEPPAPR"
     MLKGFKDFIM RGNVVDLAVG VVIGAAFTGV VTQLTKSFLE PLVRVFIALI TGSEDGLSGS        60
     TPKFRGIPFD WVAFVNAAIT FVLTAAALYF LVVYPMNRLA ERRKRGEEPP PSAPSEEVKL       120
     LTEIRDALLA GNHGTPGQRS ALDDVLGRRQ EPPAPR                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page