(data stored in SCRATCH zone)

EMBL: CP002399.PE288

CP002399.PE288       Location/Qualifiers
FT   CDS             complement(285916..286272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0290"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="KEGG: nda:Ndas_5267 anti-sigma-factor antagonist;
FT                   TIGRFAM: anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05842"
FT                   /inference="protein motif:TFAM:TIGR00377"
FT                   /protein_id="ADU05842.1"
FT                   /translation="MSLTVHTEQRGDVVVVSVAGELDMATAPQLQDQITDLLDKGRSRL
FT                   VFDLAEVSFCDSTGLSVFVRAKNNCDEAGGVVRLAAPQRGVLRILEVSGLVEVLHTYPT
FT                   VEQAVAGDPNPASS"
     MSLTVHTEQR GDVVVVSVAG ELDMATAPQL QDQITDLLDK GRSRLVFDLA EVSFCDSTGL        60
     SVFVRAKNNC DEAGGVVRLA APQRGVLRIL EVSGLVEVLH TYPTVEQAVA GDPNPASS         118
//

If you have problems or comments...

PBIL Back to PBIL home page