(data stored in SCRATCH zone)

EMBL: CP002399.PE30

CP002399.PE30        Location/Qualifiers
FT   CDS             complement(30791..32560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0030"
FT                   /product="prolyl-tRNA synthetase"
FT                   /note="KEGG: saq:Sare_3553 prolyl-tRNA synthetase; TIGRFAM:
FT                   prolyl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); YbaK/prolyl-tRNA synthetase associated region;
FT                   Anticodon-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05584"
FT                   /inference="protein motif:TFAM:TIGR00409"
FT                   /protein_id="ADU05584.1"
FT                   /translation="MLLRMSTLLLRTLREDPADAEVPSHRLLLRAGYVRRAAPGGYTWL
FT                   PLGKLVLDRITAIVRDEMTGIGDQEVHFPALLPAEPYRTSGRWTEYGDDIFTLADRKGA
FT                   EHLLAPTHEELAALLVKDLFTSYRDFPVTLFQIQTKFRDEARPRAGLLRGREFLMKDAY
FT                   SFDLDEAGLQAAYDRHRAAYERVFTRLGLDFTTVHAMSGAMGGSASEEFLAATPVGEDT
FT                   FVGCTACDYAANTEAVVTRAPAAGDPDAYPPAEVHDTPETPTIAALVELAEARELGGRT
FT                   GWTAADTLKNVVLTVRRAGAEQGEPLVIGLPGDREVDLKRVEAVLAPATVAVFEDWDAH
FT                   PELVRGYIGPQILAKHGIRYLVDPRVVPGTSWLTGANEPGRHATDVVCGRDFVPDGTIE
FT                   AAEVRPGDSCPACADGELTIRRGIEIGHIFQLGRRYTDAFAVDVLGPEGKPVRPTMGCY
FT                   GIGVSRAVAAVAEQHHDDRGLVWPAAVAPCDVHLIAAGKGPQLDAALDLGGRLAAAGLR
FT                   VLVDDRTHVSAGVKFTDAELIGIPRAVVVGRRLAEGYVELRDRATGERTELPVEAIVER
FT                   LRDEAGATRRDGV"
     MLLRMSTLLL RTLREDPADA EVPSHRLLLR AGYVRRAAPG GYTWLPLGKL VLDRITAIVR        60
     DEMTGIGDQE VHFPALLPAE PYRTSGRWTE YGDDIFTLAD RKGAEHLLAP THEELAALLV       120
     KDLFTSYRDF PVTLFQIQTK FRDEARPRAG LLRGREFLMK DAYSFDLDEA GLQAAYDRHR       180
     AAYERVFTRL GLDFTTVHAM SGAMGGSASE EFLAATPVGE DTFVGCTACD YAANTEAVVT       240
     RAPAAGDPDA YPPAEVHDTP ETPTIAALVE LAEARELGGR TGWTAADTLK NVVLTVRRAG       300
     AEQGEPLVIG LPGDREVDLK RVEAVLAPAT VAVFEDWDAH PELVRGYIGP QILAKHGIRY       360
     LVDPRVVPGT SWLTGANEPG RHATDVVCGR DFVPDGTIEA AEVRPGDSCP ACADGELTIR       420
     RGIEIGHIFQ LGRRYTDAFA VDVLGPEGKP VRPTMGCYGI GVSRAVAAVA EQHHDDRGLV       480
     WPAAVAPCDV HLIAAGKGPQ LDAALDLGGR LAAAGLRVLV DDRTHVSAGV KFTDAELIGI       540
     PRAVVVGRRL AEGYVELRDR ATGERTELPV EAIVERLRDE AGATRRDGV                   589
//

If you have problems or comments...

PBIL Back to PBIL home page