(data stored in SCRATCH zone)

EMBL: CP002399.PE303

CP002399.PE303       Location/Qualifiers
FT   CDS             306246..306803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0305"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: saq:Sare_4522 response regulator receiver
FT                   protein; PFAM: response regulator receiver; SMART: response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05857"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADU05857.1"
FT                   /translation="MTQTAKALLVDDRRENLMALEAILQGLPVQSVAVESGEAALKQLL
FT                   VDDFAVILLDAQMPDMDGFETATHIKRRERTRHVPIIFLTAADKDAQLALRGYAAGAVD
FT                   YLTKPFDPWVLRAKVTVFVDLWVKTRQLAAQSDLVRERDLQWRHLTDAVDEATALLRAD
FT                   DDPSARDRAVELLEQARWGNTR"
     MTQTAKALLV DDRRENLMAL EAILQGLPVQ SVAVESGEAA LKQLLVDDFA VILLDAQMPD        60
     MDGFETATHI KRRERTRHVP IIFLTAADKD AQLALRGYAA GAVDYLTKPF DPWVLRAKVT       120
     VFVDLWVKTR QLAAQSDLVR ERDLQWRHLT DAVDEATALL RADDDPSARD RAVELLEQAR       180
     WGNTR                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page