(data stored in SCRATCH zone)

EMBL: CP002399.PE310

CP002399.PE310       Location/Qualifiers
FT   CDS             313266..313898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0312"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: saq:Sare_4519
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05864"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ADU05864.1"
FT                   /translation="MHVLRHGEVHNPDGILYGRLPGFRLSELGVQMAKAAAQALADRTV
FT                   VHVVASPLERAQQTAEPIAAQFGLSVGVDERLIESANWFEGKKVSPGDGSFRDPRNWWV
FT                   LRDPVTPSWGEAYRAIAERMFAALHAARVAAEGREAVLVSHQLPIWTLRRHVERKRLWH
FT                   DPRRRQCGLASLTSFHFDGAKIVGIGYSEPAAHLVSISPTARTAKGA"
     MHVLRHGEVH NPDGILYGRL PGFRLSELGV QMAKAAAQAL ADRTVVHVVA SPLERAQQTA        60
     EPIAAQFGLS VGVDERLIES ANWFEGKKVS PGDGSFRDPR NWWVLRDPVT PSWGEAYRAI       120
     AERMFAALHA ARVAAEGREA VLVSHQLPIW TLRRHVERKR LWHDPRRRQC GLASLTSFHF       180
     DGAKIVGIGY SEPAAHLVSI SPTARTAKGA                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page