(data stored in SCRATCH zone)

EMBL: CP002399.PE326

CP002399.PE326       Location/Qualifiers
FT   CDS             327011..328105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0328"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: stp:Strop_4089
FT                   pyridoxal-5'-phosphate-dependent enzyme, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05880"
FT                   /inference="protein motif:PFAM:PF00291"
FT                   /protein_id="ADU05880.1"
FT                   /translation="MTHLDRCDEASRRWVTEAIATVEADANRSADTHLLPFPLPREWGI
FT                   DLYLKDESVHPTGSLKHRLARSLFLYGLCNGWIGPDTTIVEASSGSTAVSEAYFARMLG
FT                   LPFIAVMPASTSPEKIAQIEFQGGRCHLVDDPSKVVVEARWLAEDSGGRFMDQFTYAER
FT                   ATDWRGNNNIAESIYAQLALERHPVPAWIVVGAGTGGTSATIGRYARYRRLPTKLCVVD
FT                   PENSAFYPAWQAGDWSVRTDRGSRIEGIGRPTVEASFLPSVVDRMVQVPDAASLAAMRA
FT                   GSAVLGRRVGGSTGTNLWGAFGLIAQMRAAGRTGSVVTLICDPGDRYVDTYYSDEWVAA
FT                   QGLDLAPHLATIDRFLTDATWPAA"
     MTHLDRCDEA SRRWVTEAIA TVEADANRSA DTHLLPFPLP REWGIDLYLK DESVHPTGSL        60
     KHRLARSLFL YGLCNGWIGP DTTIVEASSG STAVSEAYFA RMLGLPFIAV MPASTSPEKI       120
     AQIEFQGGRC HLVDDPSKVV VEARWLAEDS GGRFMDQFTY AERATDWRGN NNIAESIYAQ       180
     LALERHPVPA WIVVGAGTGG TSATIGRYAR YRRLPTKLCV VDPENSAFYP AWQAGDWSVR       240
     TDRGSRIEGI GRPTVEASFL PSVVDRMVQV PDAASLAAMR AGSAVLGRRV GGSTGTNLWG       300
     AFGLIAQMRA AGRTGSVVTL ICDPGDRYVD TYYSDEWVAA QGLDLAPHLA TIDRFLTDAT       360
     WPAA                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page