(data stored in SCRATCH zone)

EMBL: CP002399.PE342

CP002399.PE342       Location/Qualifiers
FT   CDS             complement(345729..346616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0344"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: sro:Sros_2548 ABC transporter related protein;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05896"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU05896.1"
FT                   /translation="MILAQAEQVSRRYGDVLALDRVDLTVRAGELVGLLGPNGAGKSTL
FT                   INLLVGLRRPTAGRVELCGGDPRDPASRRQLGVTPQETGLPGTLRVGEVVDFVSAHFPD
FT                   PVPRGELLDRFGLADQVRRQTGGLSGGQRRRLAVALAFVGRPRLVVLDEPTTGLDVEAR
FT                   HALWDAIRGFHADGGTVLLSSHYLEEVEALAQRVVVIGHGRVLADDSVAAIRGIVGVRR
FT                   VSLVADDLPALPGVVTTERADGRVHLLTTDADQLVRDLVTSGVPFHDLEVRPTSLEEAF
FT                   LAITADDRPAPTPA"
     MILAQAEQVS RRYGDVLALD RVDLTVRAGE LVGLLGPNGA GKSTLINLLV GLRRPTAGRV        60
     ELCGGDPRDP ASRRQLGVTP QETGLPGTLR VGEVVDFVSA HFPDPVPRGE LLDRFGLADQ       120
     VRRQTGGLSG GQRRRLAVAL AFVGRPRLVV LDEPTTGLDV EARHALWDAI RGFHADGGTV       180
     LLSSHYLEEV EALAQRVVVI GHGRVLADDS VAAIRGIVGV RRVSLVADDL PALPGVVTTE       240
     RADGRVHLLT TDADQLVRDL VTSGVPFHDL EVRPTSLEEA FLAITADDRP APTPA            295
//

If you have problems or comments...

PBIL Back to PBIL home page