(data stored in SCRATCH zone)

EMBL: CP002399.PE352

CP002399.PE352       Location/Qualifiers
FT   CDS             354122..354973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0354"
FT                   /product="protein of unknown function DUF178"
FT                   /note="PFAM: protein of unknown function DUF178; KEGG:
FT                   stp:Strop_4076 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05906"
FT                   /inference="protein motif:PFAM:PF02621"
FT                   /protein_id="ADU05906.1"
FT                   /translation="MADRIARPRVGHIQFLNCLPIYWGLMRSGALIDVDLHKDSPDRLS
FT                   ADLVAGDLDIGPITLVEFLKHADDLLLLPDLAVGSDGPVLSVNVVSTRPLGELDGARVA
FT                   LGSTSRTGVLLAQLLLAERHGVRPEYFRCPPDLTQMLLEADAGVLIGDVALRALYEAPA
FT                   KGLEVTDLGQAWHDWTGLPMVFAVWAVRREFAAAHPGLVKEVHEAFLRSRDLCLAELDQ
FT                   VAEAAARWETFDAATLATYFRALDFSLGERQVAGLREFARRAAAHGEVPALPAGGPEFF
FT                   QG"
     MADRIARPRV GHIQFLNCLP IYWGLMRSGA LIDVDLHKDS PDRLSADLVA GDLDIGPITL        60
     VEFLKHADDL LLLPDLAVGS DGPVLSVNVV STRPLGELDG ARVALGSTSR TGVLLAQLLL       120
     AERHGVRPEY FRCPPDLTQM LLEADAGVLI GDVALRALYE APAKGLEVTD LGQAWHDWTG       180
     LPMVFAVWAV RREFAAAHPG LVKEVHEAFL RSRDLCLAEL DQVAEAAARW ETFDAATLAT       240
     YFRALDFSLG ERQVAGLREF ARRAAAHGEV PALPAGGPEF FQG                         283
//

If you have problems or comments...

PBIL Back to PBIL home page