(data stored in SCRATCH zone)

EMBL: CP002399.PE428

CP002399.PE428       Location/Qualifiers
FT   CDS             439625..439954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0430"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_4021 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05982"
FT                   /inference="similar to AA sequence:KEGG:Strop_4021"
FT                   /protein_id="ADU05982.1"
FT                   /translation="MPRGEIDEAWIEEAVRRYRRIENLQAEFDQAVATVEVTVRSPDGL
FT                   VEVVVTAGGRITDVRFLGPLHHRSPRDVAGSVQAAVTAAADAAQWAREKLHNETFAAYR
FT                   PLAGA"
     MPRGEIDEAW IEEAVRRYRR IENLQAEFDQ AVATVEVTVR SPDGLVEVVV TAGGRITDVR        60
     FLGPLHHRSP RDVAGSVQAA VTAAADAAQW AREKLHNETF AAYRPLAGA                   109
//

If you have problems or comments...

PBIL Back to PBIL home page