(data stored in SCRATCH zone)

EMBL: CP002399.PE43

CP002399.PE43        Location/Qualifiers
FT   CDS             39418..40548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0043"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_3157 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05597"
FT                   /inference="similar to AA sequence:KEGG:Strop_3157"
FT                   /protein_id="ADU05597.1"
FT                   /translation="MNQDRLRFDLADLAEEVTPVDLRDRALRTSRRLGIQRAVATSAAA
FT                   LVVLAAATGTALAIRPNSQAPAPAGPSVTVTAPPVEPSRTPSTDPSRTSSADASTATGQ
FT                   AQSSLAGTRYYLQQTSTRSRIHEVRGTQDRVVHEVVHEAASRCEANTVSISPDGKRVVW
FT                   VQDSTDNANGVLLIATVGEKGATTLAEGISCLGARPLRWKGDDLLMVQRKNRQSVLYDV
FT                   TANKQVVGDPGQETKRCWSADGTWLAAESDGKPYVSDTTDLRQYTYTPPQQEAAKWDGW
FT                   EARSVSTDGRYVAVGWIGTDPSRRDGSFAVVDTRTSKVVDLPGTGEVRSILFSADGTVL
FT                   LRRGTGVTVLDREFKPLGTVTEPAPTRNRALLAYVP"
     MNQDRLRFDL ADLAEEVTPV DLRDRALRTS RRLGIQRAVA TSAAALVVLA AATGTALAIR        60
     PNSQAPAPAG PSVTVTAPPV EPSRTPSTDP SRTSSADAST ATGQAQSSLA GTRYYLQQTS       120
     TRSRIHEVRG TQDRVVHEVV HEAASRCEAN TVSISPDGKR VVWVQDSTDN ANGVLLIATV       180
     GEKGATTLAE GISCLGARPL RWKGDDLLMV QRKNRQSVLY DVTANKQVVG DPGQETKRCW       240
     SADGTWLAAE SDGKPYVSDT TDLRQYTYTP PQQEAAKWDG WEARSVSTDG RYVAVGWIGT       300
     DPSRRDGSFA VVDTRTSKVV DLPGTGEVRS ILFSADGTVL LRRGTGVTVL DREFKPLGTV       360
     TEPAPTRNRA LLAYVP                                                       376
//

If you have problems or comments...

PBIL Back to PBIL home page