(data stored in SCRATCH zone)

EMBL: CP002399.PE44

CP002399.PE44        Location/Qualifiers
FT   CDS             40651..41733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0044"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_3157 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05598"
FT                   /inference="similar to AA sequence:KEGG:Strop_3157"
FT                   /protein_id="ADU05598.1"
FT                   /translation="MQIETDVWECIRDAHQPTPEDRIVNVIVTSARGLRTVAALAAAAF
FT                   VAVGVSACGDGGSTPSAPAAGQSSAAAPSSAAPSPSDASSAALPGTRYYLSFGEQAAEV
FT                   HVVKGGTDRVSASVPYGGGDCVRNTITISPYGERLAWVEGAAGAEAGKLVTTRIDGSDR
FT                   ATIAAEPPFSGKAPCDGGDPLVWNTNDRVLVQQDGHMALIDLSSRKPADGDAGNETLKW
FT                   WTPDGRNWAAVSEGRPYATTDPKVTFYRYTPPAAQAARYDGWRVRSVSADGRYVAVGWI
FT                   NKDETRNDGSFAVVDTRTSKVVDLPGTGEVRGILFSTDGTVLVRRDNGISVLDKRFQPV
FT                   GTVTEPAGLSGAPLLAYVPA"
     MQIETDVWEC IRDAHQPTPE DRIVNVIVTS ARGLRTVAAL AAAAFVAVGV SACGDGGSTP        60
     SAPAAGQSSA AAPSSAAPSP SDASSAALPG TRYYLSFGEQ AAEVHVVKGG TDRVSASVPY       120
     GGGDCVRNTI TISPYGERLA WVEGAAGAEA GKLVTTRIDG SDRATIAAEP PFSGKAPCDG       180
     GDPLVWNTND RVLVQQDGHM ALIDLSSRKP ADGDAGNETL KWWTPDGRNW AAVSEGRPYA       240
     TTDPKVTFYR YTPPAAQAAR YDGWRVRSVS ADGRYVAVGW INKDETRNDG SFAVVDTRTS       300
     KVVDLPGTGE VRGILFSTDG TVLVRRDNGI SVLDKRFQPV GTVTEPAGLS GAPLLAYVPA       360
//

If you have problems or comments...

PBIL Back to PBIL home page