(data stored in SCRATCH zone)

EMBL: CP002399.PE442

CP002399.PE442       Location/Qualifiers
FT   CDS             complement(453106..453978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0445"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   saq:Sare_4361 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05996"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADU05996.1"
FT                   /translation="MTRPLDPGTPGRFRHHRRLDVLIPTRNRPAELAVTLSGLAAQEGV
FT                   PGFGVVVSDQSDGDPAYAHPAAATMVRALRHRGHPVLLTRRLPRRGLAEHRSYLLAQSA
FT                   ADAVLCLDDDVWLEPGALSRLVTALDELGCGFVGNAVHGLSYADDVRPETHQHYEEWTG
FT                   PPVPERIQPGTPEWHRASIHPAANLLHVTEKLDLAADEWRAYKISWIGGCVLYDRAKLV
FT                   EAGGFDFWERLPERHQGEDVAAQLAVLERHGGAGVLPSGAYHLESPTTVTERDVEAWEV
FT                   VLSESPAEV"
     MTRPLDPGTP GRFRHHRRLD VLIPTRNRPA ELAVTLSGLA AQEGVPGFGV VVSDQSDGDP        60
     AYAHPAAATM VRALRHRGHP VLLTRRLPRR GLAEHRSYLL AQSAADAVLC LDDDVWLEPG       120
     ALSRLVTALD ELGCGFVGNA VHGLSYADDV RPETHQHYEE WTGPPVPERI QPGTPEWHRA       180
     SIHPAANLLH VTEKLDLAAD EWRAYKISWI GGCVLYDRAK LVEAGGFDFW ERLPERHQGE       240
     DVAAQLAVLE RHGGAGVLPS GAYHLESPTT VTERDVEAWE VVLSESPAEV                  290
//

If you have problems or comments...

PBIL Back to PBIL home page