(data stored in SCRATCH zone)

EMBL: CP002399.PE444

CP002399.PE444       Location/Qualifiers
FT   CDS             455940..456497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0447"
FT                   /product="intracellular protease, PfpI family"
FT                   /note="KEGG: rxy:Rxyl_2045 peptidase C56, PfpI; TIGRFAM:
FT                   intracellular protease, PfpI family; PFAM: ThiJ/PfpI
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05998"
FT                   /inference="protein motif:TFAM:TIGR01382"
FT                   /protein_id="ADU05998.1"
FT                   /translation="MAATLQGKRIAFLAADGVEEVEYTKPREAVENAGAQVELVSIESG
FT                   TIQAFNHLDHGKQYQVDVTTEEADAGAYDGLVLPGGVANPDFLRTDPEAVRFVRAFFDA
FT                   GKPVGVICHGPWTLVEADVVRGRTITSWPSLRTDLTNAGAKWVDQEVVTDNGLVSSRKP
FT                   DDLPAFCAKIVEEFAEGRHAAR"
     MAATLQGKRI AFLAADGVEE VEYTKPREAV ENAGAQVELV SIESGTIQAF NHLDHGKQYQ        60
     VDVTTEEADA GAYDGLVLPG GVANPDFLRT DPEAVRFVRA FFDAGKPVGV ICHGPWTLVE       120
     ADVVRGRTIT SWPSLRTDLT NAGAKWVDQE VVTDNGLVSS RKPDDLPAFC AKIVEEFAEG       180
     RHAAR                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page