(data stored in SCRATCH zone)

EMBL: CP002399.PE452

CP002399.PE452       Location/Qualifiers
FT   CDS             complement(464589..465341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0455"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase FKBP-type; KEGG:
FT                   stp:Strop_3970 peptidylprolyl isomerase, FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06006"
FT                   /inference="protein motif:PFAM:PF00254"
FT                   /protein_id="ADU06006.1"
FT                   /translation="MGTLGLRAGTVCAGLGGGPPGAHPPTLQGVDVSERVENRSAGQAP
FT                   ATKAQRRLAAQLAEKKAAEARRRRQSILGAAVGVLAVVALVGGLVWLNSGDDDKTSTAG
FT                   SSASPTAPAEPTAAPAPELPAGFDPALKTKPTVQAGTGELKKLTVTTLVKGTGPAVKAG
FT                   QNITTNYVGVFYKDGKQFDASWDSGQPATFQIGVGQVIKGWDQGLVGVPVGSRVQLDLP
FT                   AELAYGNDAAGGRPAGPLRFVVDVLAAQ"
     MGTLGLRAGT VCAGLGGGPP GAHPPTLQGV DVSERVENRS AGQAPATKAQ RRLAAQLAEK        60
     KAAEARRRRQ SILGAAVGVL AVVALVGGLV WLNSGDDDKT STAGSSASPT APAEPTAAPA       120
     PELPAGFDPA LKTKPTVQAG TGELKKLTVT TLVKGTGPAV KAGQNITTNY VGVFYKDGKQ       180
     FDASWDSGQP ATFQIGVGQV IKGWDQGLVG VPVGSRVQLD LPAELAYGND AAGGRPAGPL       240
     RFVVDVLAAQ                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page