(data stored in SCRATCH zone)

EMBL: CP002399.PE471

CP002399.PE471       Location/Qualifiers
FT   CDS             complement(484191..485408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0474"
FT                   /product="isocitrate dehydrogenase, NADP-dependent"
FT                   /note="KEGG: saq:Sare_4173 isocitrate dehydrogenase;
FT                   TIGRFAM: isocitrate dehydrogenase, NADP-dependent; PFAM:
FT                   isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06025"
FT                   /inference="protein motif:TFAM:TIGR00127"
FT                   /protein_id="ADU06025.1"
FT                   /translation="MAKIKVNNPVVEIDGDEMTRIIWKQIREQLILPYLDVDLHYYDLS
FT                   IQHRDATDDQVTVDAANAIKEHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILG
FT                   GVVFREPIIMSNVPRLVPGWTKPIIIGRHAHGDQYKATDFVVPGPGTVTITYTPADGGT
FT                   PMEMEVANFPGGGIAMGMYNYDESIRDFARASFRYGLDRGYPVYMSTKNTILKAYDGRF
FT                   KDIFAEVFENEFKAEFEAAGLTYEHRLIDDMVAAALKWEGGYVWACKNYDGDVQSDTVA
FT                   QGFGSLGLMTSVLLSPDGRTVEAEAAHGTVTRHYRQYQKGEKTSTNPIASIYAWTRGLA
FT                   HRGKLDGTPAVTEFADTLEKVIVDTVEGGQMTKDLALLISRDAPWLTTDEFMNALDENL
FT                   ARKLAA"
     MAKIKVNNPV VEIDGDEMTR IIWKQIREQL ILPYLDVDLH YYDLSIQHRD ATDDQVTVDA        60
     ANAIKEHGVG VKCATITPDE ARVEEFGLKK MWRSPNGTIR NILGGVVFRE PIIMSNVPRL       120
     VPGWTKPIII GRHAHGDQYK ATDFVVPGPG TVTITYTPAD GGTPMEMEVA NFPGGGIAMG       180
     MYNYDESIRD FARASFRYGL DRGYPVYMST KNTILKAYDG RFKDIFAEVF ENEFKAEFEA       240
     AGLTYEHRLI DDMVAAALKW EGGYVWACKN YDGDVQSDTV AQGFGSLGLM TSVLLSPDGR       300
     TVEAEAAHGT VTRHYRQYQK GEKTSTNPIA SIYAWTRGLA HRGKLDGTPA VTEFADTLEK       360
     VIVDTVEGGQ MTKDLALLIS RDAPWLTTDE FMNALDENLA RKLAA                       405
//

If you have problems or comments...

PBIL Back to PBIL home page