(data stored in SCRATCH zone)

EMBL: CP002399.PE474

CP002399.PE474       Location/Qualifiers
FT   CDS             complement(487519..488382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0477"
FT                   /product="Methenyltetrahydrofolate cyclohydrolase"
FT                   /EC_number="3.5.4.9"
FT                   /note="KEGG: saq:Sare_4175 bifunctional
FT                   5,10-methylene-tetrahydrofolate
FT                   dehydrogenase/5,10-methylene-tetrahydrofolate
FT                   cyclohydrolase; PFAM: Tetrahydrofolate
FT                   dehydrogenase/cyclohydrolase, NAD(P)-binding domain;
FT                   Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06028"
FT                   /inference="protein motif:PRIAM:3.5.4.9"
FT                   /protein_id="ADU06028.1"
FT                   /translation="MTATILDGKATAAEIKDELRARVKALAERGITPGLGTVLVGEDPG
FT                   SQAYVNGKHRDCAEVGIASLRVALPADASQEQLDAALAELNADPACHGYIVQLPLPGHL
FT                   DTQRALESIDPDKDADGLHPVNLGRLVLGYDAPLPCTPRGIVELLRRHDVPLRGANVAV
FT                   VGRGNTVGRPLGLLLTRRSENATVTLCHTGTLDLAAHTRAADVVIVAAGVPGLLTADMI
FT                   NPGATVVDVGITRVIGEDGKGRYTGDVDPEVAEVAGKLVPMPGGVGPMTRAMLLTNVVE
FT                   RAERTA"
     MTATILDGKA TAAEIKDELR ARVKALAERG ITPGLGTVLV GEDPGSQAYV NGKHRDCAEV        60
     GIASLRVALP ADASQEQLDA ALAELNADPA CHGYIVQLPL PGHLDTQRAL ESIDPDKDAD       120
     GLHPVNLGRL VLGYDAPLPC TPRGIVELLR RHDVPLRGAN VAVVGRGNTV GRPLGLLLTR       180
     RSENATVTLC HTGTLDLAAH TRAADVVIVA AGVPGLLTAD MINPGATVVD VGITRVIGED       240
     GKGRYTGDVD PEVAEVAGKL VPMPGGVGPM TRAMLLTNVV ERAERTA                     287
//

If you have problems or comments...

PBIL Back to PBIL home page