(data stored in SCRATCH zone)

EMBL: CP002399.PE484

CP002399.PE484       Location/Qualifiers
FT   CDS             complement(498581..499897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0488"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4200 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06038"
FT                   /inference="similar to AA sequence:KEGG:Sare_4200"
FT                   /protein_id="ADU06038.1"
FT                   /translation="MSRVTPDQPRRPATGPPAGARPPGRARPAARVPAPRSGEEPRSRA
FT                   PLPVAAGVAALWAALTSWLPVSAVLGLAQLSEDAGSFGGALRAGLAGWLLGHGVPLQTT
FT                   AGPLGLAPLALSALAVWRLTRAGVHVSRAVGARGAGSPRQALTVAVAVGIGYALLGALA
FT                   AFAVDAGGLRVSPVTAALTFAAFGVPAALVGALRTTGVWALLAERCPPPVRDGLRTGLV
FT                   AALLLCGAGAGAAGLAVATGGGDAADMIGAYRTGVAGQAGITLVSLAYAPNATAWSASY
FT                   LLGPGFAVGTDTAVRTSEVSVGALPAVPLLAGLPRGPMDGLGGALLAVPVLAAMAAGWL
FT                   LARRLLRAAAEERTEVGWPALLLPAALAGPVAGALLGLFAAASGGSLGGGRLAEVGPSP
FT                   WAVAAVATLVIGVGAVLGAAATRTLTCPTPPPRATPAPR"
     MSRVTPDQPR RPATGPPAGA RPPGRARPAA RVPAPRSGEE PRSRAPLPVA AGVAALWAAL        60
     TSWLPVSAVL GLAQLSEDAG SFGGALRAGL AGWLLGHGVP LQTTAGPLGL APLALSALAV       120
     WRLTRAGVHV SRAVGARGAG SPRQALTVAV AVGIGYALLG ALAAFAVDAG GLRVSPVTAA       180
     LTFAAFGVPA ALVGALRTTG VWALLAERCP PPVRDGLRTG LVAALLLCGA GAGAAGLAVA       240
     TGGGDAADMI GAYRTGVAGQ AGITLVSLAY APNATAWSAS YLLGPGFAVG TDTAVRTSEV       300
     SVGALPAVPL LAGLPRGPMD GLGGALLAVP VLAAMAAGWL LARRLLRAAA EERTEVGWPA       360
     LLLPAALAGP VAGALLGLFA AASGGSLGGG RLAEVGPSPW AVAAVATLVI GVGAVLGAAA       420
     TRTLTCPTPP PRATPAPR                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page