(data stored in SCRATCH zone)

EMBL: CP002399.PE491

CP002399.PE491       Location/Qualifiers
FT   CDS             complement(505518..507929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0495"
FT                   /product="ATP-dependent DNA helicase PcrA"
FT                   /note="KEGG: saq:Sare_4207 ATP-dependent DNA helicase PcrA;
FT                   TIGRFAM: ATP-dependent DNA helicase PcrA; PFAM: UvrD/REP
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06045"
FT                   /inference="protein motif:TFAM:TIGR01073"
FT                   /protein_id="ADU06045.1"
FT                   /translation="MHPLFDIPTSPPAPESPPAPESRPTPPRRPGGAGSDPAALLDGLN
FT                   GPQRDAVTHAGSPLLIVAGAGSGKTRVLTNRIAYLLAARDVHPGEIIAITFTNKAAGEM
FT                   KERVAALVGPRARLMWVSTFHSACVRILRAEHEHAGLKSTFSIYDADDSRRLMQMVARE
FT                   LDLDPKRYPARGLAAQVSNLKNELVDPEEFAGRAKGPNERALAEAYTLYQRRLREAHAL
FT                   DFDDLIMTTVHLLQSHPHVAESYRRRFRHVLVDEYQDTNHAQYVLIKELVSGTEGIPPA
FT                   ELCVVGDADQSIYAFRGATIRNILEFERDFTDARTILLEQNYRSTQTILNAANAVIDRN
FT                   TSRKPKRLWSDAGSGEQIVGYVADTEHAEADWVAREIDRLVDDGETRPGDVAVFYRTNA
FT                   MSRVFEEVFIRVGLPYKVVGGVRFYERKEVRDALAYLRAVVNDDDTVSLRRVLNTPRRG
FT                   IGERAEACVEALSARDRISFGAALRRAKDAPGISTRAANGIAEFVALLDAARELAGTGT
FT                   PEEVLEAVLTRSGYLAELEESLDPQDAGRVDNLQELVSVAREYTERIEALGADDERATL
FT                   AGFLEQVALVADADQIPSDDPDHQGVVTLMTLHTAKGLEFPVVFLTGLEDGVFPHLRSL
FT                   GDTRELEEERRLAYVGITRARQRLYLSRAVTRSAWGAPAYNPPSRFLEELPPELVRWER
FT                   TEGSYTSWGGGGGGVGGRADRLGRSGFAGGTPKATELAKRLGVDASRLATASELKQAPK
FT                   VAVGDRVNHQRYGLGRVLAVEGAGPGARAQIDFGDQTMWLVLRHAPIDKL"
     MHPLFDIPTS PPAPESPPAP ESRPTPPRRP GGAGSDPAAL LDGLNGPQRD AVTHAGSPLL        60
     IVAGAGSGKT RVLTNRIAYL LAARDVHPGE IIAITFTNKA AGEMKERVAA LVGPRARLMW       120
     VSTFHSACVR ILRAEHEHAG LKSTFSIYDA DDSRRLMQMV ARELDLDPKR YPARGLAAQV       180
     SNLKNELVDP EEFAGRAKGP NERALAEAYT LYQRRLREAH ALDFDDLIMT TVHLLQSHPH       240
     VAESYRRRFR HVLVDEYQDT NHAQYVLIKE LVSGTEGIPP AELCVVGDAD QSIYAFRGAT       300
     IRNILEFERD FTDARTILLE QNYRSTQTIL NAANAVIDRN TSRKPKRLWS DAGSGEQIVG       360
     YVADTEHAEA DWVAREIDRL VDDGETRPGD VAVFYRTNAM SRVFEEVFIR VGLPYKVVGG       420
     VRFYERKEVR DALAYLRAVV NDDDTVSLRR VLNTPRRGIG ERAEACVEAL SARDRISFGA       480
     ALRRAKDAPG ISTRAANGIA EFVALLDAAR ELAGTGTPEE VLEAVLTRSG YLAELEESLD       540
     PQDAGRVDNL QELVSVAREY TERIEALGAD DERATLAGFL EQVALVADAD QIPSDDPDHQ       600
     GVVTLMTLHT AKGLEFPVVF LTGLEDGVFP HLRSLGDTRE LEEERRLAYV GITRARQRLY       660
     LSRAVTRSAW GAPAYNPPSR FLEELPPELV RWERTEGSYT SWGGGGGGVG GRADRLGRSG       720
     FAGGTPKATE LAKRLGVDAS RLATASELKQ APKVAVGDRV NHQRYGLGRV LAVEGAGPGA       780
     RAQIDFGDQT MWLVLRHAPI DKL                                               803
//

If you have problems or comments...

PBIL Back to PBIL home page