(data stored in SCRATCH zone)

EMBL: CP002399.PE495

CP002399.PE495       Location/Qualifiers
FT   CDS             complement(510721..511704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0499"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ami:Amir_0678
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06049"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU06049.1"
FT                   /translation="MSDPNTASIVSTPPATMPTEAGSGAPTNAGLPESAKQNKPRGLLG
FT                   DAWIDLRRKPLFWISATIILVFLVMAAFPWLFTSGDAVNGSLDRSRVEPSSAAWFGYDV
FT                   QGRDVYARVIYGARASIVVAVVSTFLTLLVGGTMGIIAGYRGGWVDALLSRIADIFFGL
FT                   PFVLGSIVILTTFNGSGTDNGEWTIMGLVILSLSVLSWPVVMRLMRSSVLATKEADYIV
FT                   AARALGAGTGRIILKHLLPNCLAPLLVYGTIMVGSFIGAEATLSFLGIGLRHPVVSWGI
FT                   MISEAQNYIRVSPYLLFFPAAFLVAAVLSFVMLGEAVREALDPKLR"
     MSDPNTASIV STPPATMPTE AGSGAPTNAG LPESAKQNKP RGLLGDAWID LRRKPLFWIS        60
     ATIILVFLVM AAFPWLFTSG DAVNGSLDRS RVEPSSAAWF GYDVQGRDVY ARVIYGARAS       120
     IVVAVVSTFL TLLVGGTMGI IAGYRGGWVD ALLSRIADIF FGLPFVLGSI VILTTFNGSG       180
     TDNGEWTIMG LVILSLSVLS WPVVMRLMRS SVLATKEADY IVAARALGAG TGRIILKHLL       240
     PNCLAPLLVY GTIMVGSFIG AEATLSFLGI GLRHPVVSWG IMISEAQNYI RVSPYLLFFP       300
     AAFLVAAVLS FVMLGEAVRE ALDPKLR                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page