(data stored in SCRATCH zone)

EMBL: CP002399.PE509

CP002399.PE509       Location/Qualifiers
FT   CDS             528211..529311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0513"
FT                   /product="cell envelope-related transcriptional attenuator"
FT                   /note="KEGG: saq:Sare_4011 cell envelope-related
FT                   transcriptional attenuator; TIGRFAM: cell envelope-related
FT                   function transcriptional attenuator, LytR/CpsA family;
FT                   PFAM: cell envelope-related transcriptional attenuator"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06063"
FT                   /inference="protein motif:TFAM:TIGR00350"
FT                   /protein_id="ADU06063.1"
FT                   /translation="MTRRRLLGLAALVAALLVATGAVVTTRLVANRPAAPAAGPSTAPP
FT                   ASPTPAPTTASPTPPPGADLKGPLNLLLVGVDTRVSIPGWEPHADAVLLLHVPAGLDKA
FT                   YLFSLPRDLVVDIPPYPKARYPGGRTKLTHAMSYGSRVPGDKRNPSTAQGYELLRTTVS
FT                   RYTGLRIDAGAVITFGGFDKLVDTLGGVDLYVDQRVESRHRRPDGTMRTLTGGGYTGPQ
FT                   MVYEKGTRHLTGWQALDYARQRYTAGGDYTRQRHQQQLLRALARKILDQGTARDPQRVE
FT                   QVVAALGKTLVYAGGGRKLIDYAYVLGGLPADRLTLVVLPGAGVSSGGAYRGEQLKPLG
FT                   RDFLTALRGRRADAFLAAHPSLRVKN"
     MTRRRLLGLA ALVAALLVAT GAVVTTRLVA NRPAAPAAGP STAPPASPTP APTTASPTPP        60
     PGADLKGPLN LLLVGVDTRV SIPGWEPHAD AVLLLHVPAG LDKAYLFSLP RDLVVDIPPY       120
     PKARYPGGRT KLTHAMSYGS RVPGDKRNPS TAQGYELLRT TVSRYTGLRI DAGAVITFGG       180
     FDKLVDTLGG VDLYVDQRVE SRHRRPDGTM RTLTGGGYTG PQMVYEKGTR HLTGWQALDY       240
     ARQRYTAGGD YTRQRHQQQL LRALARKILD QGTARDPQRV EQVVAALGKT LVYAGGGRKL       300
     IDYAYVLGGL PADRLTLVVL PGAGVSSGGA YRGEQLKPLG RDFLTALRGR RADAFLAAHP       360
     SLRVKN                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page