(data stored in SCRATCH zone)

EMBL: CP002399.PE53

CP002399.PE53        Location/Qualifiers
FT   CDS             49569..50714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0053"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG: mpt:Mpe_A1733
FT                   2-polyprenyl-6-methoxyphenol hydroxylase-related
FT                   FAD-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05607"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ADU05607.1"
FT                   /translation="MLPERTDVLVVGAGPTGLAVAVTLAGHGVTATVVDRLAEPPVTSR
FT                   AAVVHAGTLEVLDRIGIAAPLAARGLRSARFSVRDRDRVLVTVPFDRLPSRYPYALLIS
FT                   QAETEAVLADRLTALGGRVLRPYEMTGLDLDGDGAVARFGGGRAVRARWVVGADGMHSR
FT                   VRELAGIGFGGPADPGESFLLADVHVDSTLPRDQVSLFLSRQGPLVWAPLPDGTVRLVA
FT                   TVDDAPRDPQAHHFQALLDERGPARRPDRVTGMAWSSRFRIHHRIASTYRSGPVLLAGD
FT                   AAHVHSPAGGQGMNLGLRDAVALGDALAAGPQALDGYATDRRPLAEEVLGFAAGLTRLA
FT                   AAPPAVRPLRNLLLRAVSTLPPVRHRIAVRLAGFEPARPDS"
     MLPERTDVLV VGAGPTGLAV AVTLAGHGVT ATVVDRLAEP PVTSRAAVVH AGTLEVLDRI        60
     GIAAPLAARG LRSARFSVRD RDRVLVTVPF DRLPSRYPYA LLISQAETEA VLADRLTALG       120
     GRVLRPYEMT GLDLDGDGAV ARFGGGRAVR ARWVVGADGM HSRVRELAGI GFGGPADPGE       180
     SFLLADVHVD STLPRDQVSL FLSRQGPLVW APLPDGTVRL VATVDDAPRD PQAHHFQALL       240
     DERGPARRPD RVTGMAWSSR FRIHHRIAST YRSGPVLLAG DAAHVHSPAG GQGMNLGLRD       300
     AVALGDALAA GPQALDGYAT DRRPLAEEVL GFAAGLTRLA AAPPAVRPLR NLLLRAVSTL       360
     PPVRHRIAVR LAGFEPARPD S                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page