(data stored in SCRATCH zone)

EMBL: CP002399.PE538

CP002399.PE538       Location/Qualifiers
FT   CDS             complement(559430..560548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0542"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="TIGRFAM: alanine racemase; KEGG: saq:Sare_4247
FT                   alanine racemase; PFAM: alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06092"
FT                   /inference="protein motif:TFAM:TIGR00492"
FT                   /protein_id="ADU06092.1"
FT                   /translation="MWQSEVRVDLDAIRENVTRLKAGTSAELMAVVKGDGYGHGMVPAA
FT                   RAALDAGADQLGVCTLDEALRLREEGITAPVLAWLLSPGLPLHDGITVGVDLGCAGLTQ
FT                   LDEMIQASRRADRPARLHLKIDTGLARGGATVADWPALLEAAAKAQADGLVEVVGVWSH
FT                   FVYADSPGHPTTDRQLAVFQEGLEMVTRAGLRPRYRHLANSAATLTRPDTHFDLVRPGI
FT                   AVYGLSPVAGEQFGLRPAMTARARVMLTKRVAAGTGVSYGHTYLTEQEANLAVVPLGYA
FT                   DGVPRHASNTGPVQLAGKRRTISGRVCMDQFVVDCGDDEVADGDVATLFGSGADGEPTA
FT                   DDWAEAVGTINYEIVTRFGGVRVPRVYDGEHA"
     MWQSEVRVDL DAIRENVTRL KAGTSAELMA VVKGDGYGHG MVPAARAALD AGADQLGVCT        60
     LDEALRLREE GITAPVLAWL LSPGLPLHDG ITVGVDLGCA GLTQLDEMIQ ASRRADRPAR       120
     LHLKIDTGLA RGGATVADWP ALLEAAAKAQ ADGLVEVVGV WSHFVYADSP GHPTTDRQLA       180
     VFQEGLEMVT RAGLRPRYRH LANSAATLTR PDTHFDLVRP GIAVYGLSPV AGEQFGLRPA       240
     MTARARVMLT KRVAAGTGVS YGHTYLTEQE ANLAVVPLGY ADGVPRHASN TGPVQLAGKR       300
     RTISGRVCMD QFVVDCGDDE VADGDVATLF GSGADGEPTA DDWAEAVGTI NYEIVTRFGG       360
     VRVPRVYDGE HA                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page