(data stored in SCRATCH zone)

EMBL: CP002399.PE540

CP002399.PE540       Location/Qualifiers
FT   CDS             562319..562621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0544"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ami:Amir_3480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06094"
FT                   /inference="similar to AA sequence:KEGG:Amir_3480"
FT                   /protein_id="ADU06094.1"
FT                   /translation="MVEKPFDVDPELLRSVARELADDAYRLARGPGAAPESLLVAAPDG
FT                   WRSAVALAELESAVRRWSGALGARVADTAQALRRGADGYEAVDERAARRLTGVLR"
     MVEKPFDVDP ELLRSVAREL ADDAYRLARG PGAAPESLLV AAPDGWRSAV ALAELESAVR        60
     RWSGALGARV ADTAQALRRG ADGYEAVDER AARRLTGVLR                             100
//

If you have problems or comments...

PBIL Back to PBIL home page