(data stored in SCRATCH zone)

EMBL: CP002399.PE541

CP002399.PE541       Location/Qualifiers
FT   CDS             562618..564240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0545"
FT                   /product="protein of unknown function DUF1023"
FT                   /note="PFAM: protein of unknown function DUF1023; KEGG:
FT                   sna:Snas_0412 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06095"
FT                   /inference="protein motif:PFAM:PF06259"
FT                   /protein_id="ADU06095.1"
FT                   /translation="MNDGPADAVDVPVGYAQLWRADPGAWSTAGAAWRGITTPVRQRAD
FT                   ALTARIGTLRPGWSGAASTAAQRRIGDLRTDLTDVLPALVEVDQVLAEFGARLGAAKAR
FT                   LGAEVARAESGGLLVDRTGAVRPDPARPPGQTGPAVVDARAGIRGALTLAGAADREAAG
FT                   RLAELTTAAVRGWVSVPPAWRPGPGAGPAEVSRWWAGLSAAERRWLVGREPGRIGRLDG
FT                   LPAAVRDQANRLLLGDRREQLLARRLGLLHPLPAGPLEASRRVRLAAVEAALRGLDGLG
FT                   ERLAAGGAPRAYLLGLDPAGDGRAVVALGNPDRAASVLTYVPGMTSDLADAPAELGRAA
FT                   RVLQRCAALGPGEEAAAVLWLDYDAPGFLTEAAGTRQAEDAGPALHRFQDGLRAAHEGP
FT                   PARQTVLGHSYGSLVVGTAARDHGLGADALVFVGSPGVGVDHAAELRMPAGQVWSSTAP
FT                   DDVIRLARPPDELARRALLAGTPLGPALAVLDPHGERLWFGADPSAPDFGGRRFPSAPH
FT                   GHTGYWDPDNPALDGMARIVLGR"
     MNDGPADAVD VPVGYAQLWR ADPGAWSTAG AAWRGITTPV RQRADALTAR IGTLRPGWSG        60
     AASTAAQRRI GDLRTDLTDV LPALVEVDQV LAEFGARLGA AKARLGAEVA RAESGGLLVD       120
     RTGAVRPDPA RPPGQTGPAV VDARAGIRGA LTLAGAADRE AAGRLAELTT AAVRGWVSVP       180
     PAWRPGPGAG PAEVSRWWAG LSAAERRWLV GREPGRIGRL DGLPAAVRDQ ANRLLLGDRR       240
     EQLLARRLGL LHPLPAGPLE ASRRVRLAAV EAALRGLDGL GERLAAGGAP RAYLLGLDPA       300
     GDGRAVVALG NPDRAASVLT YVPGMTSDLA DAPAELGRAA RVLQRCAALG PGEEAAAVLW       360
     LDYDAPGFLT EAAGTRQAED AGPALHRFQD GLRAAHEGPP ARQTVLGHSY GSLVVGTAAR       420
     DHGLGADALV FVGSPGVGVD HAAELRMPAG QVWSSTAPDD VIRLARPPDE LARRALLAGT       480
     PLGPALAVLD PHGERLWFGA DPSAPDFGGR RFPSAPHGHT GYWDPDNPAL DGMARIVLGR       540
//

If you have problems or comments...

PBIL Back to PBIL home page