(data stored in SCRATCH zone)

EMBL: CP002399.PE542

CP002399.PE542       Location/Qualifiers
FT   CDS             complement(564360..566273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0546"
FT                   /product="glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /note="KEGG: stp:Strop_3860
FT                   glucosamine--fructose-6-phosphate aminotransferase;
FT                   TIGRFAM: glucosamine/fructose-6-phosphate aminotransferase,
FT                   isomerizing; PFAM: sugar isomerase (SIS); glutamine
FT                   amidotransferase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06096"
FT                   /inference="protein motif:TFAM:TIGR01135"
FT                   /protein_id="ADU06096.1"
FT                   /translation="MCGIVGYAGARPALGIVLDGLRRLEYRGYDSAGVAVVCEDELLTE
FT                   KKAGKLANLEKVLSERAADNPEDCAASPIGIGDGTTGIGHTRWATHGGPTDRNAHPHLS
FT                   PDGRVAVIHNGIIENFAKLRAELEDEGVEFASDTDTECAAHLIARALADLRSAGETDSP
FT                   ALLAAAMRVVCARLEGAFTLLAVDAGIPGAVVGARRNSPLVVGRGDGENYLASDVAAFI
FT                   EHTRDAVELGQDQIVLITPDSIDITDFHGQPASGTDFHIDWDSSAAEKGGYDWFMLKEI
FT                   EEQPQAIADTLLGRLTETGEIALDEVRLSEQDLRDVDKIFIVACGTSYHAGLVAKYAIE
FT                   HWTRIPCEVELASEFRYRDPVLDRSTLIVVISQSGETMDTLMALRHAKEQKARVLAICN
FT                   TNGSTIPRESDAVLYTHGGPEIAVASTKAFLTQVVACYLIGLHLAQVRGIKFADEVGAV
FT                   VAQLQEMPGKLRELLDRIEPVRELGRELKSEPTVLFIGRHVGYPVALEGALKLKELAYM
FT                   HAEGFAAGELKHGPISLIDQGTPVICIVPSPVGRGMLHDKVVSNIQEVRARGARTIVIA
FT                   EEGDQAVVRYADHLIYVPRTPTLLAPLVTTVPLQVLAAEIAAARGHDVDQPRNLAKSVT
FT                   VE"
     MCGIVGYAGA RPALGIVLDG LRRLEYRGYD SAGVAVVCED ELLTEKKAGK LANLEKVLSE        60
     RAADNPEDCA ASPIGIGDGT TGIGHTRWAT HGGPTDRNAH PHLSPDGRVA VIHNGIIENF       120
     AKLRAELEDE GVEFASDTDT ECAAHLIARA LADLRSAGET DSPALLAAAM RVVCARLEGA       180
     FTLLAVDAGI PGAVVGARRN SPLVVGRGDG ENYLASDVAA FIEHTRDAVE LGQDQIVLIT       240
     PDSIDITDFH GQPASGTDFH IDWDSSAAEK GGYDWFMLKE IEEQPQAIAD TLLGRLTETG       300
     EIALDEVRLS EQDLRDVDKI FIVACGTSYH AGLVAKYAIE HWTRIPCEVE LASEFRYRDP       360
     VLDRSTLIVV ISQSGETMDT LMALRHAKEQ KARVLAICNT NGSTIPRESD AVLYTHGGPE       420
     IAVASTKAFL TQVVACYLIG LHLAQVRGIK FADEVGAVVA QLQEMPGKLR ELLDRIEPVR       480
     ELGRELKSEP TVLFIGRHVG YPVALEGALK LKELAYMHAE GFAAGELKHG PISLIDQGTP       540
     VICIVPSPVG RGMLHDKVVS NIQEVRARGA RTIVIAEEGD QAVVRYADHL IYVPRTPTLL       600
     APLVTTVPLQ VLAAEIAAAR GHDVDQPRNL AKSVTVE                                637
//

If you have problems or comments...

PBIL Back to PBIL home page