(data stored in SCRATCH zone)

EMBL: CP002399.PE553

CP002399.PE553       Location/Qualifiers
FT   CDS             575286..575741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0557"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro11110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06107"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro11110"
FT                   /protein_id="ADU06107.1"
FT                   /translation="MYRLRRKRPEHSEQAIGGQRRRFVQAFPYGLVTGYSPNDVPCPPD
FT                   PDDRHVLAAAVHGRADILVTDDRRAFPPECVRESLSVRTGDEFLNWVADRSMPLVMRTL
FT                   ARQIDYYRRSLVAEDKDAVELIAHLRKAGASRFADRLENHLADPSGR"
     MYRLRRKRPE HSEQAIGGQR RRFVQAFPYG LVTGYSPNDV PCPPDPDDRH VLAAAVHGRA        60
     DILVTDDRRA FPPECVRESL SVRTGDEFLN WVADRSMPLV MRTLARQIDY YRRSLVAEDK       120
     DAVELIAHLR KAGASRFADR LENHLADPSG R                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page