(data stored in SCRATCH zone)

EMBL: CP002399.PE555

CP002399.PE555       Location/Qualifiers
FT   CDS             576571..578682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0559"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="KEGG: stp:Strop_3867 molybdopterin oxidoreductase;
FT                   manually curated; PFAM: molybdopterin oxidoreductase;
FT                   molybdopterin oxidoreductase Fe4S4 region; molydopterin
FT                   dinucleotide-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06109"
FT                   /inference="protein motif:PFAM:PF00384"
FT                   /protein_id="ADU06109.1"
FT                   /translation="MTDGARTATRTGSRLVEAATHCPYCALQCGMVLRATGDGVEVGAR
FT                   DFPTNRGGLCQKGWTAADLLDHPDRLTTPLLRDRPGGELRPATWDEALDRVAAGVKDVQ
FT                   HHHGPDAVAVFGGGGLTNEKAYALGRFARVTLRTRHIDYNGRWCMSSAAAAGNRAFGID
FT                   RGLPFPLADLGHADTLLLVGANPAETMPPLMRHVADLRERGGRLIVVDPRATATARQAD
FT                   LHLQPLPGTDLAVANALLHIALTEGWLDRAYVAERTTGFDDVRRTVAGYWPAEVERLSG
FT                   VPVADLYATARALATVDRAVVLTARGAEQHAKGVDTVTAFINLALALGLPGRPGSGYGC
FT                   LTGQGNGQGGREHGQKADQLPGYRRIDDPAAREHVAGVWGVEPDSLPGPGVPAYQLLDA
FT                   LGTPSGARALLVFGSNPVVSAPRAARVESRLRALDLLVVADFVRSETAELADVVLPVAQ
FT                   WAEEDGTMTNLEGRVLRRRALREPPAGVRTELEILAALAERLTGGGTPLPADPREVFAE
FT                   LGRASAGGPADYAGITWDRIDADTGVFWPCPDRDGPDTPRLFADRFPTPDGRARFHAVT
FT                   HRPAAEPVCADYPLHFTTGRVLAQYQSGAQTRRVAALRRAAPGGFVELHPDLAARIGVT
FT                   DGAPVRVVSRRGELRAPARLSTAIRPDTVFAPFHWPGAQRANSVTNDALDPVSGMPEFK
FT                   ICAVRVEAA"
     MTDGARTATR TGSRLVEAAT HCPYCALQCG MVLRATGDGV EVGARDFPTN RGGLCQKGWT        60
     AADLLDHPDR LTTPLLRDRP GGELRPATWD EALDRVAAGV KDVQHHHGPD AVAVFGGGGL       120
     TNEKAYALGR FARVTLRTRH IDYNGRWCMS SAAAAGNRAF GIDRGLPFPL ADLGHADTLL       180
     LVGANPAETM PPLMRHVADL RERGGRLIVV DPRATATARQ ADLHLQPLPG TDLAVANALL       240
     HIALTEGWLD RAYVAERTTG FDDVRRTVAG YWPAEVERLS GVPVADLYAT ARALATVDRA       300
     VVLTARGAEQ HAKGVDTVTA FINLALALGL PGRPGSGYGC LTGQGNGQGG REHGQKADQL       360
     PGYRRIDDPA AREHVAGVWG VEPDSLPGPG VPAYQLLDAL GTPSGARALL VFGSNPVVSA       420
     PRAARVESRL RALDLLVVAD FVRSETAELA DVVLPVAQWA EEDGTMTNLE GRVLRRRALR       480
     EPPAGVRTEL EILAALAERL TGGGTPLPAD PREVFAELGR ASAGGPADYA GITWDRIDAD       540
     TGVFWPCPDR DGPDTPRLFA DRFPTPDGRA RFHAVTHRPA AEPVCADYPL HFTTGRVLAQ       600
     YQSGAQTRRV AALRRAAPGG FVELHPDLAA RIGVTDGAPV RVVSRRGELR APARLSTAIR       660
     PDTVFAPFHW PGAQRANSVT NDALDPVSGM PEFKICAVRV EAA                         703
//

If you have problems or comments...

PBIL Back to PBIL home page