(data stored in SCRATCH zone)

EMBL: CP002399.PE565

CP002399.PE565       Location/Qualifiers
FT   CDS             complement(590403..591233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0569"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: stp:Strop_3877
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06119"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU06119.1"
FT                   /translation="MTQSTEARPEAPPRPAVRRGMAVRPAAVGLPALGLVIAVAAWWLV
FT                   TSGLNLVHPAALPPPQAVGKSLAGTTEVLLPALGITTWMTVFGFLLSSAAGVLIGMALA
FT                   ASRRVERMFAPLLVAVNAVPKIAFGPLLVVAVGWGQKPILTMVFLLCFFPIVLSTATGL
FT                   TTTPADLAELGRSLNASWWQSFRKVRFPAALPQIFVGLKVAMPLAAIGAVIGEFYSDRP
FT                   GLGYQILQYNGVGDTATAWAAIVLVALMSIVLYAVLSLVERLALPWVRATTSAR"
     MTQSTEARPE APPRPAVRRG MAVRPAAVGL PALGLVIAVA AWWLVTSGLN LVHPAALPPP        60
     QAVGKSLAGT TEVLLPALGI TTWMTVFGFL LSSAAGVLIG MALAASRRVE RMFAPLLVAV       120
     NAVPKIAFGP LLVVAVGWGQ KPILTMVFLL CFFPIVLSTA TGLTTTPADL AELGRSLNAS       180
     WWQSFRKVRF PAALPQIFVG LKVAMPLAAI GAVIGEFYSD RPGLGYQILQ YNGVGDTATA       240
     WAAIVLVALM SIVLYAVLSL VERLALPWVR ATTSAR                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page