(data stored in SCRATCH zone)

EMBL: CP002399.PE570

CP002399.PE570       Location/Qualifiers
FT   CDS             594765..597434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0574"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4273 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06124"
FT                   /inference="similar to AA sequence:KEGG:Sare_4273"
FT                   /protein_id="ADU06124.1"
FT                   /translation="MAFRTWGRLLLTALGVSVLAGAGQLGIAYGFGVVRLDGAFVDVSV
FT                   NRWPAQLVWVGWFAAVATVAGAVLTERFARRDDSPGGTTELLSIAGVSALGATVVAPLC
FT                   MQPARAAELGGSVDPVWAAGICAALGAVVGAGAAIAVLLKPPFGWGVAITAGIVWLMAL
FT                   LSVAPTIVSSRPLATVRLGVLEPSWLDPEAAQRLSMLLLPVLTLLAGGAVGVLARRAEW
FT                   PPLVGGAAGAAGPVLVAFAYLTAGPGSATDRYQVAPYYGALIAVIAGALGSTATTVLPR
FT                   PVTATGDPDAVEATDILAPLPHSSTPGAPAAPPAPPVTSGAAAPAHWNWPEPGGSATAT
FT                   APAGTDLPAAGRPALADRPAVDQPAVAERPAGERPAVADTGHGQPMPGLLPPGRRTSAI
FT                   DVLAAGRPDPVPVAGPGTDMGTGPVPGTDVGTAHAGGTGEAVTTDRAGTADRAVAGSEP
FT                   ADATSGQATGVPDSEAASGTGSAAGTDDAAPEPPQEAAATTPRVTRPRRTRASRSSGTT
FT                   DRSTSPADATAPRPADAASPSAAAGTTSEATSPATGGTAEGHVPGPRTDSGALAGPVTA
FT                   DADSDTPAAPPAEATGDTGATGRSTRSRRPRAPKAGPRATGPASPGSGPADAAPTTPIE
FT                   QADARSTMPSSPADAPLTTPSSPAPRTDAPTGDVAPTGRPGRNFFFDDPAPTPSSRPRF
FT                   PMFEDVTGAPGEVRPAWPITPAARPHRATTEPDAPARDDAEASAPAEPAPRPRHRGLPE
FT                   PGASTGWDALATNARPAGPLARPEAGRPVARPEAATAAPGEAGAALPEAAAAETEADSR
FT                   RGRHAEPDDADASGGKPKTRRGLFRRNRAKGDPEPADRTAEPGAEADDEYVDWVAGLAS
FT                   DDNADDARSLRTGRHHRE"
     MAFRTWGRLL LTALGVSVLA GAGQLGIAYG FGVVRLDGAF VDVSVNRWPA QLVWVGWFAA        60
     VATVAGAVLT ERFARRDDSP GGTTELLSIA GVSALGATVV APLCMQPARA AELGGSVDPV       120
     WAAGICAALG AVVGAGAAIA VLLKPPFGWG VAITAGIVWL MALLSVAPTI VSSRPLATVR       180
     LGVLEPSWLD PEAAQRLSML LLPVLTLLAG GAVGVLARRA EWPPLVGGAA GAAGPVLVAF       240
     AYLTAGPGSA TDRYQVAPYY GALIAVIAGA LGSTATTVLP RPVTATGDPD AVEATDILAP       300
     LPHSSTPGAP AAPPAPPVTS GAAAPAHWNW PEPGGSATAT APAGTDLPAA GRPALADRPA       360
     VDQPAVAERP AGERPAVADT GHGQPMPGLL PPGRRTSAID VLAAGRPDPV PVAGPGTDMG       420
     TGPVPGTDVG TAHAGGTGEA VTTDRAGTAD RAVAGSEPAD ATSGQATGVP DSEAASGTGS       480
     AAGTDDAAPE PPQEAAATTP RVTRPRRTRA SRSSGTTDRS TSPADATAPR PADAASPSAA       540
     AGTTSEATSP ATGGTAEGHV PGPRTDSGAL AGPVTADADS DTPAAPPAEA TGDTGATGRS       600
     TRSRRPRAPK AGPRATGPAS PGSGPADAAP TTPIEQADAR STMPSSPADA PLTTPSSPAP       660
     RTDAPTGDVA PTGRPGRNFF FDDPAPTPSS RPRFPMFEDV TGAPGEVRPA WPITPAARPH       720
     RATTEPDAPA RDDAEASAPA EPAPRPRHRG LPEPGASTGW DALATNARPA GPLARPEAGR       780
     PVARPEAATA APGEAGAALP EAAAAETEAD SRRGRHAEPD DADASGGKPK TRRGLFRRNR       840
     AKGDPEPADR TAEPGAEADD EYVDWVAGLA SDDNADDARS LRTGRHHRE                   889
//

If you have problems or comments...

PBIL Back to PBIL home page