(data stored in SCRATCH zone)

EMBL: CP002399.PE572

CP002399.PE572       Location/Qualifiers
FT   CDS             complement(599091..600653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0576"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /note="KEGG: stp:Strop_3884 phosphomethylpyrimidine kinase;
FT                   TIGRFAM: phosphomethylpyrimidine kinase; PFAM:
FT                   Phosphomethylpyrimidine kinase type-1; thiamine
FT                   monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06126"
FT                   /inference="protein motif:TFAM:TIGR00097"
FT                   /protein_id="ADU06126.1"
FT                   /translation="MTALRVADPGTEAPLEGRPRTRIYTGPTGVVLLTDRRVAKGALVD
FT                   VVAGAVGGGVRWVVLREKDLPRAERLALAVELRAILAEAGGTLVVAGPDPLDGDAVHLP
FT                   AAGPYPPPAVGLVGRSCHDTAELARLTTEHYATLSPVYETRTKPGYGPALRPTGLRELI
FT                   AASKVPVLALGGIETTAQVTACVEAGATGVAVLGAIMRAPDPTETATTLGRAFEEAATR
FT                   VARTHPARSDQGPHAAAPTATTVGRSRHSNHRRREPVTPKTVLSIAGSDSGAGAGIQAD
FT                   LKTFAALGAYGTSVLTAVTAQSTRGVDALLPLPPQTVRDQMDSVLGDFDVRAVKTGMLG
FT                   TPAVADAVAEAARAGRLPHLVVDPVLVATSGHRLGVVEAVERLLPYAEVATPNCAEAAA
FT                   LTGGPVGTVEEMVAAAEALAARGPAFVVVTGGDVDADGESVDVLAGGGTTRLLRAPRVD
FT                   TRHNHGTGCSFSAAVAVRLAAGDAVPVAVAAAKEYVTRALTGARTWELGAGRGPLDHFG
FT                   WSA"
     MTALRVADPG TEAPLEGRPR TRIYTGPTGV VLLTDRRVAK GALVDVVAGA VGGGVRWVVL        60
     REKDLPRAER LALAVELRAI LAEAGGTLVV AGPDPLDGDA VHLPAAGPYP PPAVGLVGRS       120
     CHDTAELARL TTEHYATLSP VYETRTKPGY GPALRPTGLR ELIAASKVPV LALGGIETTA       180
     QVTACVEAGA TGVAVLGAIM RAPDPTETAT TLGRAFEEAA TRVARTHPAR SDQGPHAAAP       240
     TATTVGRSRH SNHRRREPVT PKTVLSIAGS DSGAGAGIQA DLKTFAALGA YGTSVLTAVT       300
     AQSTRGVDAL LPLPPQTVRD QMDSVLGDFD VRAVKTGMLG TPAVADAVAE AARAGRLPHL       360
     VVDPVLVATS GHRLGVVEAV ERLLPYAEVA TPNCAEAAAL TGGPVGTVEE MVAAAEALAA       420
     RGPAFVVVTG GDVDADGESV DVLAGGGTTR LLRAPRVDTR HNHGTGCSFS AAVAVRLAAG       480
     DAVPVAVAAA KEYVTRALTG ARTWELGAGR GPLDHFGWSA                             520
//

If you have problems or comments...

PBIL Back to PBIL home page